Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLFN12 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SLFN12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170707
|
Novus Biologicals
NBP170707 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SLFN12 Polyclonal specifically detects SLFN12 in Human samples. It is validated for Western Blot.Specifications
| SLFN12 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| schlafen family member 12 | |
| SLFN12 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 55106 | |
| Synthetic peptides corresponding to SLFN12(schlafen family member 12) The peptide sequence was selected from the middle region of SLFN12. Peptide sequence KYLLKALFKALKRLKSLRDQFSFAENLYQIIGIDCFQKNDKKMFKSCRRL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title