Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLITRK6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16242520UL
Description
SLITRK6 Polyclonal specifically detects SLITRK6 in Human samples. It is validated for Western Blot.Specifications
SLITRK6 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q9H5Y7 | |
SLITRK6 | |
Synthetic peptides corresponding to SLITRK6(SLIT and NTRK-like family, member 6) The peptide sequence was selected from the N terminal of SLITRK6. Peptide sequence NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL. | |
Affinity Purified | |
RUO | |
84189 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ22774, MGC119595, MGC119596, MGC119597,4832410J21Rik, SLIT and NTRK-like family, member 6, SLIT and NTRK-like protein 6, slit and trk like gene 6 | |
Rabbit | |
95 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction