Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLMO2 Rabbit, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | SLMO2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15685920
|
Novus Biologicals
NBP15685920UL |
20 μL |
Each for $152.22
|
|
NBP156859
|
Novus Biologicals
NBP156859 |
100 μL |
Each for $436.00
|
|
Description
SLMO2 Polyclonal specifically detects SLMO2 in Human samples. It is validated for Western Blot.Specifications
| SLMO2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C20orf45, chromosome 20 open reading frame 45, dJ543J19.5, PRELID3B, protein slowmo homolog 2, slowmo homolog 2 (Drosophila) | |
| SLMO2 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| A5GFX0 | |
| 51012 | |
| Synthetic peptides corresponding to SLMO2(slowmo homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of SLMO2. Peptide sequence GVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title