Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLMO2 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen SLMO2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15685920
View Documents
Novus Biologicals
NBP15685920UL
20 μL
Each for $152.22
Add to cart
 
NBP156859
View Documents
Novus Biologicals
NBP156859
100 μL
Each for $436.00
Add to cart
 
Description

Description

SLMO2 Polyclonal specifically detects SLMO2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SLMO2
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
C20orf45, chromosome 20 open reading frame 45, dJ543J19.5, PRELID3B, protein slowmo homolog 2, slowmo homolog 2 (Drosophila)
SLMO2
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
A5GFX0
51012
Synthetic peptides corresponding to SLMO2(slowmo homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of SLMO2. Peptide sequence GVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit