Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMARCA5/SNF2H Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31088325UL

 View more versions of this product

Catalog No. NB126668


Add to cart

Description

Description

SMARCA5/SNF2H Polyclonal antibody specifically detects SMARCA5/SNF2H in Human samples. It is validated for Western Blot, ChIP assay
Specifications

Specifications

SMARCA5/SNF2H
Unconjugated
PBS buffer, 2% sucrose
EC 3.6.1, EC 3.6.4.-, hISWI, hSNF2HSWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5, ISWI, SNF2Hsucrose nonfermenting-like 5, subfamily a, member 5, Sucrose nonfermenting protein 2 homolog, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 5, WCRF135
The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCA5/SNF2H (NP_003592). Peptide sequence AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE
25 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot, ChIP assay
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Purified
Rabbit
Affinity purified
RUO
Primary
8467
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit