Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMARCA5/SNF2H Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen SMARCA5/SNF2H
Dilution Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Applications Western Blot, ChIP assay
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126667
View Documents
Novus Biologicals
NBP310883100UL
100 μg
Each for $320.71
Add to cart
 
NB126668
View Documents
Novus Biologicals
NBP31088325UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

SMARCA5/SNF2H Polyclonal antibody specifically detects SMARCA5/SNF2H in Human samples. It is validated for Western Blot, ChIP assay
Specifications

Specifications

SMARCA5/SNF2H
Western Blot, ChIP assay
Purified
RUO
PBS buffer, 2% sucrose
8467
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Unconjugated
Rabbit
Human
EC 3.6.1, EC 3.6.4.-, hISWI, hSNF2HSWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5, ISWI, SNF2Hsucrose nonfermenting-like 5, subfamily a, member 5, Sucrose nonfermenting protein 2 homolog, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 5, WCRF135
The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCA5/SNF2H (NP_003592). Peptide sequence AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit