Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SMARCA6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | SMARCA6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157145
|
Novus Biologicals
NBP157145 |
100 μL |
Each of 1 for $436.00
|
|
Description
SMARCA6 Polyclonal specifically detects SMARCA6 in Human samples. It is validated for Western Blot.Specifications
SMARCA6 | |
Polyclonal | |
Rabbit | |
Core ESC Like Genes, Stem Cell Markers | |
EC 3.6.1, EC 3.6.4.-, helicase, lymphoid-specific, LSHSWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin, Nbla10143, PASGFLJ10339, Proliferation-associated SNF2-like protein, SMARCA6lymphoid-specific helicase, subfamily A, member 6, SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6 | |
HELLS | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q9NRZ9 | |
3070 | |
Synthetic peptides corresponding to HELLS(helicase, lymphoid-specific) The peptide sequence was selected from the middle region of HELLS. Peptide sequence QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title