Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMARCD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31047225UL

 View more versions of this product

Catalog No. NB125846

Add to cart



SMARCD2 Polyclonal antibody specifically detects SMARCD2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)


PBS buffer, 2% sucrose
60 kDa BRG-1/Brm-associated factor subunit B, BAF60B, BRG1-associated factor 60B, chromatin remodeling complex BAF60B subunit, CRACD2, mammalian chromatin remodeling complex BRG1-associated factor 60B, PRO2451, Rsc6p, SWI/SNF complex 60 kDa subunit B, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2, Swp73-like protein
The immunogen is a synthetic peptide directed towards the C terminal region of human SMARCD2 (NP_003068). Peptide sequence STDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRH
25 μg
Chromatin Research
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Affinity purified
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit