Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMCR7L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179453

 View more versions of this product

Catalog No. NBP179453

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

SMCR7L Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

SMCR7L
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
dJ1104E15.3, FLJ20232, HSU79252, MID51, Smith-Magenis syndrome chromosomal region candidate gene 7 protein-like, Smith-Magenis syndrome chromosome region, candidate 7-like
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
54471
Human
Western Blot
Western Blot 1:1000
Affinity Purified
SMCR7L
Synthetic peptide directed towards the C terminal of human HSU79252. Peptide sequence HLVVFKFLVPEAKSTTCLLVTCLPAVVVDVLAGRFGISHQSFCTVLVSSI.
17 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit