Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMEK2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $378.35

Specifications

Antigen SMEK2
Immunogen Synthetic peptide directed towards the C terminal of human Smek2The immunogen for this antibody is Smek2. Peptide sequence DSYEKFMETKKAKESEDKENLPKRASSGGFKFTFSHSPSATNGTNSTNSK.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17967320 View Documents Novus Biologicals
NBP17967320UL
20ul Each for $152.22
Add to cart
 
NBP179673 View Documents Novus Biologicals
NBP179673
100 ul Each for $378.35
Add to cart
 
Description

Description

SMEK2 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

SMEK2
Rabbit
Polyclonal
Unconjugated
57223
Affinity Purified
Western Blot
RUO
Synthetic peptide directed towards the C terminal of human Smek2The immunogen for this antibody is Smek2. Peptide sequence DSYEKFMETKKAKESEDKENLPKRASSGGFKFTFSHSPSATNGTNSTNSK.
Primary
IgG
FLFL2, FLJ31474, KIAA1387serine/threonine-protein phosphatase 4 regulatory subunit 3B, PP4R3B, PPP4R3B, PSY2, SMEK homolog 2, SMEK homolog 2, suppressor of mek1 (Dictyostelium), smk1
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit