Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMN1/SMN2 Mouse anti-Human, Clone: 2B10, Invitrogen™

Mouse Monoclonal Antibody

Manufacturer:  Invitrogen MA527878

Catalog No. PIMA527878


Add to cart

Description

Description

The synthetic peptide sequence is 22-52aa, RRGTGQSDDSDIWDDTALIKAYDKAVASFKH Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.

The SMN1 gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein - survival motor neuron protein. The SMN complex plays a catalyst role in the assemble of small nuclear ribonucleoproteins, the building blocks of the spliceosome. Mutations in the SMN1 gene are known to cause spinal muscular atrophy 1/2.
Specifications

Specifications

SMN1/SMN2
Monoclonal
Unconjugated
SMN1
Lyophilized
SMN1
A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2.
Antigen affinity chromatography
RUO
Antibody
Monoclonal
Human
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Western Blot
2B10
PBS with 4MG trehalose, 4MG trehalose and 0.05MG sodium azide, 0.05MG sodium azide
Q16637
Survival motor neuron protein, Component of gems 1, Gemin-1, SMN1, SMN, SMNT, SMN2, SMNC
Mouse
IgG1
100 μg
-20°C
Primary
6606
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit