Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SMPX Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SMPX |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP153165
|
Novus Biologicals
NBP153165 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SMPX Polyclonal specifically detects SMPX in Human samples. It is validated for Western Blot.Specifications
| SMPX | |
| Polyclonal | |
| Purified | |
| RUO | |
| B1AWX2 | |
| 23676 | |
| Synthetic peptides corresponding to SMPX(small muscle protein, X-linked) The peptide sequence was selected from the middle region of SMPX. Peptide sequence TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| small muscle protein, X-linked, small muscular protein, SRMX, Stretch-responsive skeletal muscle protein | |
| SMPX | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title