Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMPX Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen SMPX
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP153165
View Documents
Novus Biologicals
NBP153165
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

SMPX Polyclonal specifically detects SMPX in Human samples. It is validated for Western Blot.
Specifications

Specifications

SMPX
Polyclonal
Purified
RUO
B1AWX2
23676
Synthetic peptides corresponding to SMPX(small muscle protein, X-linked) The peptide sequence was selected from the middle region of SMPX. Peptide sequence TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
small muscle protein, X-linked, small muscular protein, SRMX, Stretch-responsive skeletal muscle protein
SMPX
IgG
Protein A purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit