Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SMYD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | SMYD2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB123461
|
Novus Biologicals
NBP309280100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
SMYD2 Polyclonal specifically detects SMYD2 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.Specifications
| SMYD2 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 56950 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation | |
| Unconjugated | |
| Rabbit | |
| Human | |
| EC 2.1.1.43, Histone methyltransferase SMYD2, HSKM-Bzinc finger, MYND domain containing 14, KMT3CEC 2.1.1.-, Lysine N-methyltransferase 3C, MGC119305, SET and MYND domain containing 2, SET and MYND domain-containing protein 2, ZMYND14 | |
| The immunogen is a synthetic peptide directed towards the middle region of human SMYD2 (NP_064582). Peptide sequence SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES | |
| Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title