Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMYD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179394

 View more versions of this product

Catalog No. NBP179394


Add to cart

Description

Description

SMYD3 Polyclonal antibody specifically detects SMYD3 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

SMYD3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
SMYD3
Synthetic peptide directed towards the C terminal of human SMYD3The immunogen for this antibody is SMYD3. Peptide sequence LHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS.
Immunogen affinity purified
RUO
Primary
64754
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_073580
bA74P14.1, bA74P14.1 (novel protein), EC 2.1.1, EC 2.1.1.43, FLJ21080, KMT3E, MGC104324, MYND domain containing 1, SET and MYND domain containing 3, SET and MYND domain-containing protein 3, Zinc finger MYND domain-containing protein 1, zinc finger protein, subfamily 3A (MYND domain containing), 1, ZMYND1, ZNFN3A1
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit