SMYD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179394

Catalog No. NBP179394

Description

SMYD3 Polyclonal specifically detects SMYD3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SMYD3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bA74P14.1, bA74P14.1 (novel protein), EC 2.1.1, EC 2.1.1.43, FLJ21080, KMT3E, MGC104324, MYND domain containing 1, SET and MYND domain containing 3, SET and MYND domain-containing protein 3, Zinc finger MYND domain-containing protein 1, zinc finger protein, subfamily 3A (MYND domain containing), 1, ZMYND1, ZNFN3A1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64754
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_073580
• Gene Symbols: SMYD3
• Immunogen: Synthetic peptide directed towards the C terminal of human SMYD3The immunogen for this antibody is SMYD3. Peptide sequence LHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG