Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SMYD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SMYD3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179394
|
Novus Biologicals
NBP179394 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SMYD3 Polyclonal specifically detects SMYD3 in Human samples. It is validated for Western Blot.Specifications
| SMYD3 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| bA74P14.1, bA74P14.1 (novel protein), EC 2.1.1, EC 2.1.1.43, FLJ21080, KMT3E, MGC104324, MYND domain containing 1, SET and MYND domain containing 3, SET and MYND domain-containing protein 3, Zinc finger MYND domain-containing protein 1, zinc finger protein, subfamily 3A (MYND domain containing), 1, ZMYND1, ZNFN3A1 | |
| SMYD3 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_073580 | |
| 64754 | |
| Synthetic peptide directed towards the C terminal of human SMYD3The immunogen for this antibody is SMYD3. Peptide sequence LHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title