SNAP29 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179769

Catalog No. NBP179769

Description

SNAP29 Polyclonal specifically detects SNAP29 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: SNAP29
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CEDNIKSoluble 29 kDa NSF attachment protein, SNAP-29FLJ21051, synaptosomal-associated protein 29, synaptosomal-associated protein, 29kD, synaptosomal-associated protein, 29kDa, Vesicle-membrane fusion protein SNAP-29
• Host Species: Rabbit
• Molecular Weight of Antigen: 29 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Dog: 85%; Pig: 85%; Horse: 85%; Guinea pig: 85%; Rabbit: 77%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_446262
• Gene Symbols: SNAP29
• Immunogen: The immunogen for this antibody is Snap29. Peptide sequence NSIKSVFGGFINYFKSKPVEPPPEQNGSIVPQPSSRLKEAINTSKDQESK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9342
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.