Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNAP29 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17976920UL
Description
SNAP29 Polyclonal specifically detects SNAP29 in Rat samples. It is validated for Western Blot.Specifications
SNAP29 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_446262 | |
SNAP29 | |
The immunogen for this antibody is Snap29. Peptide sequence NSIKSVFGGFINYFKSKPVEPPPEQNGSIVPQPSSRLKEAINTSKDQESK. | |
Affinity Purified | |
RUO | |
9342 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CEDNIKSoluble 29 kDa NSF attachment protein, SNAP-29FLJ21051, synaptosomal-associated protein 29, synaptosomal-associated protein, 29kD, synaptosomal-associated protein, 29kDa, Vesicle-membrane fusion protein SNAP-29 | |
Rabbit | |
29 kDa | |
20 μL | |
Primary | |
Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction