SNAP29 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16918020UL

Catalog No. NBP16918020

Description

SNAP29 Polyclonal specifically detects SNAP29 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SNAP29
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: O95721
• Gene Symbols: SNAP29
• Immunogen: Synthetic peptides corresponding to SNAP29 (synaptosomal-associated protein, 29kDa) The peptide sequence was selected from the middle region of SNAP29. Peptide sequence QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYP.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CEDNIKSoluble 29 kDa NSF attachment protein, SNAP-29FLJ21051, synaptosomal-associated protein 29, synaptosomal-associated protein, 29kD, synaptosomal-associated protein, 29kDa, Vesicle-membrane fusion protein SNAP-29
• Host Species: Rabbit
• Molecular Weight of Antigen: 29 kDa
• Quantity: 20 μL
• Research Discipline: Neuronal Cell Markers, Neurotransmission
• Gene ID (Entrez): 9342
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.