Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SNAP29 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17976920UL

 View more versions of this product

Catalog No. NBP17976920


Add to cart

Description

Description

SNAP29 Polyclonal antibody specifically detects Antigen in Rat samples. It is validated for Western Blotting.
Specifications

Specifications

SNAP29
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
SNAP29
The immunogen for this antibody is Snap29. Peptide sequence NSIKSVFGGFINYFKSKPVEPPPEQNGSIVPQPSSRLKEAINTSKDQESK.
29 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Rat
Western Blot
Western Blot 1:1000
NP_446262
CEDNIKSoluble 29 kDa NSF attachment protein, SNAP-29FLJ21051, synaptosomal-associated protein 29, synaptosomal-associated protein, 29kD, synaptosomal-associated protein, 29kDa, Vesicle-membrane fusion protein SNAP-29
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
9342
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit