SNAP45 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255746

Catalog No. NBP255746

Description

SNAP45 Polyclonal specifically detects SNAP45 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SNAP45
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Proximal sequence element-binding transcription factor subunit delta, PSE-binding factor subunit delta, PTF subunit delta, PTFdelta, small nuclear RNA activating complex, polypeptide 2, 45kD, small nuclear RNA activating complex, polypeptide 2, 45kDa, Small nuclear RNA-activating complex polypeptide 2, SNAP45snRNA-activating protein complex 45 kDa subunit, SNAPc 45 kDa subunit, SNAPc subunit 2, snRNA-activating protein complex subunit 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6618
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SNAPC2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALVEHMTETYLRLTAPQPIPAGGSLGPAAEGDGAGSKAPEETPPATEKAEHSELKSPWQAAGICPLNPFLVPLELLGRA
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only