Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SNAPC3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP257713

Catalog No. NBP257713


Add to cart

Description

Description

SNAPC3 Polyclonal antibody specifically detects SNAPC3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

SNAPC3
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
MGC132011, MGC33124, Proximal sequence element-binding transcription factor subunit beta, PSE-binding factor subunit beta, PTF subunit beta, PTFbeta, small nuclear RNA activating complex, polypeptide 3, 50kD, small nuclear RNA activating complex, polypeptide 3, 50kDa, Small nuclear RNA-activating complex polypeptide 3, SNAP50SNAPc 50 kDa subunit, SNAPc subunit 3, snRNA-activating protein complex 50 kDa subunit, snRNA-activating protein complex subunit 3
Rabbit
IgG
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Western Blot, Immunocytochemistry, Immunofluorescence
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
SNAPC3
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPELNTRAFHVGAFGELWRGRLRGAGDLSLREPPASALPGSQAADSDREDAAVARDLDCSLEAAAELRAVCGLDKLKCLEDGEDPEVIPENTDLVT
Affinity purified
RUO
Primary
6619
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only