Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SNRK Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154944

 View more versions of this product

Catalog No. NBP154944

Add to cart



SNRK Polyclonal antibody specifically detects SNRK in Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptides corresponding to SNRK(SNF related kinase) The peptide sequence was selected from the middle region of SNRK. Peptide sequence SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN.
84 kDa
100 ul
Protein Kinase
Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat
Western Blot
Western Blot 1:100-1:2000
DKFZp779A1866, EC 2.7.11, EC, HSNFRK, KIAA0096FLJ20224, SNF related kinase, SNF-1 related kinase, SNF1-related kinase, SNF-related serine/threonine-protein kinase, SNFRK
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit