SNRK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154944

Catalog No. NBP154944

Description

SNRK Polyclonal specifically detects SNRK in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SNRK
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp779A1866, EC 2.7.11, EC 2.7.11.1, HSNFRK, KIAA0096FLJ20224, SNF related kinase, SNF-1 related kinase, SNF1-related kinase, SNF-related serine/threonine-protein kinase, SNFRK
• Host Species: Rabbit
• Molecular Weight of Antigen: 84 kDa
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 54861
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NRH2
• Gene Symbols: SNRK
• Immunogen: Synthetic peptides corresponding to SNRK(SNF related kinase) The peptide sequence was selected from the middle region of SNRK. Peptide sequence SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.