Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNRK Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SNRK |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154944
|
Novus Biologicals
NBP154944 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SNRK Polyclonal specifically detects SNRK in Human samples. It is validated for Western Blot.Specifications
| SNRK | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| Q9NRH2 | |
| 54861 | |
| Synthetic peptides corresponding to SNRK(SNF related kinase) The peptide sequence was selected from the middle region of SNRK. Peptide sequence SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp779A1866, EC 2.7.11, EC 2.7.11.1, HSNFRK, KIAA0096FLJ20224, SNF related kinase, SNF-1 related kinase, SNF1-related kinase, SNF-related serine/threonine-protein kinase, SNFRK | |
| SNRK | |
| IgG | |
| Affinity Purified | |
| 84 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title