Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNRPF Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | SNRPF |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15746320
|
Novus Biologicals
NBP15746320UL |
20 μL |
Each for $152.22
|
|
NBP157463
|
Novus Biologicals
NBP157463 |
100 μL |
Each for $436.00
|
|
Description
SNRPF Polyclonal specifically detects SNRPF in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SNRPF | |
| Polyclonal | |
| Purified | |
| RUO | |
| P62306 | |
| 6636 | |
| Synthetic peptides corresponding to SNRPF (small nuclear ribonucleoprotein polypeptide F) The peptide sequence was selected from the N terminal of SNRPF. Peptide sequence MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| PBSCF, Sm protein F, small nuclear ribonucleoprotein polypeptide F, SMF, Sm-Fsmall nuclear ribonucleoprotein F, snRNP-F | |
| SNRPF | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title