Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNX26 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309643100UL
Description
SNX26 Polyclonal specifically detects SNX26 in Human samples. It is validated for Western Blot.Specifications
SNX26 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
FLJ39019, neurite outgrowth multiadaptor RhoGAP protein, NOMA-GAP, Rho GTPase activating protein 33, rho GTPase-activating protein 33, Rho-type GTPase-activating protein 33, sorting nexin 26, Sorting nexin-26, Tc10/CDC42 GTPase-activating protein, TCGAPSNX26 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of human SNX26 (NP_001166101.1). Peptide sequence PEPLYVNLALGPRGPSPASSSSSSPPAHPRSRSDPGPPVPRLPQKQRAPW | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
115703 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction