SOCS-7/Nck/NAP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158902

Catalog No. NBP158902

Description

SOCS-7/Nck/NAP4 Polyclonal specifically detects SOCS-7/Nck/NAP4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SOCS-7/Nck/NAP4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O14512
• Gene Symbols: SOCS7
• Immunogen: Synthetic peptides corresponding to SOCS7(suppressor of cytokine signaling 7) The peptide sequence was selected from the N terminal of SOCS7. Peptide sequence LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 30837
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: NAP-4, NAP4SOCS-7, Nck, Ash and phospholipase C binding protein, Nck, Ash and phospholipase C gamma-binding protein, NCKAP4, Nck-associated protein 4, SOCS6, suppressor of cytokine signaling 7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Rabbit
• Isotype: IgG