Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SOCS-7/Nck/NAP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158902
Description
SOCS-7/Nck/NAP4 Polyclonal specifically detects SOCS-7/Nck/NAP4 in Human samples. It is validated for Western Blot.Specifications
SOCS-7/Nck/NAP4 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
O14512 | |
SOCS7 | |
Synthetic peptides corresponding to SOCS7(suppressor of cytokine signaling 7) The peptide sequence was selected from the N terminal of SOCS7. Peptide sequence LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP. | |
100 μL | |
Signal Transduction | |
30837 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
NAP-4, NAP4SOCS-7, Nck, Ash and phospholipase C binding protein, Nck, Ash and phospholipase C gamma-binding protein, NCKAP4, Nck-associated protein 4, SOCS6, suppressor of cytokine signaling 7 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%. | |
Human, Mouse, Rat, Porcine, Bovine, Rabbit | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title