Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SOCS-7/Nck/NAP4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$157.00 - $482.50
Specifications
| Antigen | SOCS-7/Nck/NAP4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15890220
|
Novus Biologicals
NBP15890220UL |
20 μL |
Each for $157.00
|
|
|||||
|
NBP158902
|
Novus Biologicals
NBP158902 |
100 μL |
Each for $482.50
|
|
|||||
Description
SOCS-7/Nck/NAP4 Polyclonal specifically detects SOCS-7/Nck/NAP4 in Human samples. It is validated for Western Blot.Specifications
| SOCS-7/Nck/NAP4 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| NAP-4, NAP4SOCS-7, Nck, Ash and phospholipase C binding protein, Nck, Ash and phospholipase C gamma-binding protein, NCKAP4, Nck-associated protein 4, SOCS6, suppressor of cytokine signaling 7 | |
| SOCS7 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O14512 | |
| 30837 | |
| Synthetic peptides corresponding to SOCS7(suppressor of cytokine signaling 7) The peptide sequence was selected from the N terminal of SOCS7. Peptide sequence LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title