SOHLH1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156454

Catalog No. NBP156454

Description

SOHLH1 Polyclonal specifically detects SOHLH1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SOHLH1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: bA100C15.3, bHLHe80, C9orf157, NOHLHchromosome 9 open reading frame 157, spermatogenesis and oogenesis specific basic helix-loop-helix 1, spermatogenesis- and oogenesis-specific basic helix-loop-helix-containingprotein 1, TEB2newborn ovary helix loop helix
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 402381
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Symbols: SOHLH1
• Immunogen: Synthetic peptides corresponding to SOHLH1(spermatogenesis and oogenesis specific basic helix-loop-helix 1) The peptide sequence was selected from the middle region of SOHLH1. Peptide sequence EAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLT The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG