Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SOHLH1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180284

 View more versions of this product

Catalog No. NBP180284

Add to cart



SOHLH1 Polyclonal antibody specifically detects SOHLH1 in Mouse, Rat samples. It is validated for Western Blot.


PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
Synthetic peptide directed towards the middle region of human Sohlh1. Peptide sequence PQEMWHMWQGDVLQVTLANQIADSKPDSGIAKPSAVSRVQDPPCFGMLDT.
Immunogen affinity purified
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
bA100C15.3, bHLHe80, C9orf157, NOHLHchromosome 9 open reading frame 157, spermatogenesis and oogenesis specific basic helix-loop-helix 1, spermatogenesis- and oogenesis-specific basic helix-loop-helix-containingprotein 1, TEB2newborn ovary helix loop helix
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Expected identity based on immunogen sequence: Rat: 100%.
Mouse, Rat
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit