Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Solute carrier family 22 member 18 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | Solute carrier family 22 member 18 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15974720
|
Novus Biologicals
NBP15974720UL |
20 μL |
Each for $152.22
|
|
NBP159747
|
Novus Biologicals
NBP159747 |
100 μL |
Each for $436.00
|
|
Description
Solute carrier family 22 member 18 Polyclonal specifically detects Solute carrier family 22 member 18 in Human samples. It is validated for Western Blot.Specifications
Solute carrier family 22 member 18 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
5002 | |
Synthetic peptides corresponding to SLC22A18(solute carrier family 22, member 18) The peptide sequence was selected from the N terminal of SLC22A18. Peptide sequence AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein | |
SLC22A18 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title