Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SORBS1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP30930225UL
Description
SORBS1 Polyclonal specifically detects SORBS1 in Mouse samples. It is validated for Western Blot.Specifications
SORBS1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
c-Cbl associated protein, c-Cbl-associated protein, DKFZp451C066, DKFZp586P1422, Fas-ligand associated factor 2, FLAF2, KIAA0894, KIAA1296CAPSH3D5SH3P12FLJ12406, ponsin, R85FL, SH3 domain protein 5, SH3-domain protein 5 (ponsin), sh3p12, SORB1, sorbin and SH3 domain containing 1, sorbin and SH3 domain-containing protein 1 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse SORBS1 (NP_848139). Peptide sequence PQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKC | |
25 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
10580 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction