SOX2 Antibody (CL4716), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP259057

Catalog No. NBP259057

Description

SOX2 Monoclonal specifically detects SOX2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: SOX2
• Classification: Monoclonal
• Dilution: Western Blot 1 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated
• Gene Alias: ANOP3, MCOPS3, MGC2413, SRY (sex determining region Y)-box 2, SRY-related HMG-box gene 2, transcription factor SOX2, transcription factor SOX-2
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human SOX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SOX2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM
• Quantity: 100 μL
• Research Discipline: Cellular Markers, Core ESC Like Genes, Embryonic Stem Cell Markers, Neuronal Stem Cell Markers, Neuroscience, Sensory Systems, Stem Cell Markers, Stem Cells, Transcription Factors and Regulators, Vision
• Gene ID (Entrez): 6657
• Target Species: Human, Mouse
• Form: Purified

For Research Use Only