Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SP100 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310281100UL
Description
SP100 Polyclonal specifically detects SP100 in Mouse samples. It is validated for Western Blot.Specifications
SP100 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
DKFZp686E07254, FLJ00340, FLJ34579, lysp100b, nuclear antigen Sp100, nuclear autoantigen Sp-100, Nuclear dot-associated Sp100 protein, SP100 nuclear antigen, SP100-HMG nuclear autoantigen, Speckled 100 kDa | |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse SP100 (NP_001300641.1). Peptide sequence DFEIEGNCEKAKNWRQSIRCKGWTLRELIQKGVLQDPPRKKKETPRNPRQ | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
6672 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction