Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SP140L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180140
Description
SP140L Polyclonal specifically detects SP140L in Human samples. It is validated for Western Blot.Specifications
SP140L | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
NP_612411 | |
SP140L | |
Synthetic peptide directed towards the middle region of human LOC93349. Peptide sequence TVDFQAPLLPVTCGGVKGILHKEKLEQGTLAKCIQTEDGKWFTPMEFEIK. | |
Protein A purified | |
RUO | |
93349 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC132667, nuclear body protein SP140-like protein, SP140 nuclear body protein-like | |
Rabbit | |
39 kDa | |
100 μL | |
Primary | |
Horse: 80%; Rat: 79%. | |
Human, Rat, Equine | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title