Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SP140L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18014020UL

 View more versions of this product

Catalog No. NBP18014020


Add to cart

Description

Description

SP140L Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

SP140L
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
SP140L
Synthetic peptide directed towards the middle region of human LOC93349. Peptide sequence TVDFQAPLLPVTCGGVKGILHKEKLEQGTLAKCIQTEDGKWFTPMEFEIK.
39 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:1000
NP_612411
MGC132667, nuclear body protein SP140-like protein, SP140 nuclear body protein-like
Rabbit
IgG
Protein A purified
RUO
Primary
93349
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit