Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SP140L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$116.82 - $343.85
Specifications
| Antigen | SP140L |
|---|---|
| Immunogen | Synthetic peptide directed towards the middle region of human LOC93349. Peptide sequence TVDFQAPLLPVTCGGVKGILHKEKLEQGTLAKCIQTEDGKWFTPMEFEIK. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP18014020 |
Novus Biologicals
NBP18014020UL |
20ul |
Each for $116.82
|
|
NBP180140 |
Novus Biologicals
NBP180140 |
100ul |
Each for $343.85
|
|
Description
SP140L Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| SP140L | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 93349 | |
| Purified | |
| Western Blot | |
| RUO |
| Synthetic peptide directed towards the middle region of human LOC93349. Peptide sequence TVDFQAPLLPVTCGGVKGILHKEKLEQGTLAKCIQTEDGKWFTPMEFEIK. | |
| Primary | |
| IgG | |
| MGC132667, nuclear body protein SP140-like protein, SP140 nuclear body protein-like | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Protein A purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title