Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPACA7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SPACA7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156568
|
Novus Biologicals
NBP156568 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SPACA7 Polyclonal specifically detects SPACA7 in Human samples. It is validated for Western Blot.Specifications
| SPACA7 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q96KW9 | |
| 122258 | |
| Synthetic peptides corresponding to C13ORF28 The peptide sequence was selected from the middle region of C13orf28. Peptide sequence PGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C13orf28, chromosome 13 open reading frame 28, FLJ27356, putative uncharacterized protein C13orf28, sperm acrosome associated 7, Sperm acrosome-associated protein 7 | |
| SPACA7 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title