Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SPATA2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP17973620UL

 View more versions of this product

Catalog No. NBP17973620


Add to Cart

Description

Description

SPATA2 Polyclonal specifically detects SPATA2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SPATA2
Polyclonal
Western Blot 1:1000
NP_001129245
SPATA2
Synthetic peptide directed towards the C terminal of human SPATA2The immunogen for this antibody is SPATA2. Peptide sequence DRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD.
Affinity Purified
RUO
9825
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
KIAA0757FLJ13167, PD1spermatogenesis associated PD1, spermatogenesis associated 2, spermatogenesis-associated protein 2, Spermatogenesis-associated protein PD1, tamo
Rabbit
58 kDa
20 μL
Primary
Human
IgG
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit