Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPATA2L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | SPATA2L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SPATA2L Polyclonal specifically detects SPATA2L in Human samples. It is validated for Western Blot.Specifications
| SPATA2L | |
| Polyclonal | |
| Rabbit | |
| Q8IUW3 | |
| 124044 | |
| Synthetic peptides corresponding to SPATA2L(spermatogenesis associated 2-like) The peptide sequence was selected from the middle region of SPATA2L. Peptide sequence SPPAELAYRPPLWEQSAKLWGTGGRAWEPPAEELPQASSPPYGALEEGLE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C16orf76, chromosome 16 open reading frame 76, MGC26885, SPATA2-like protein, spermatogenesis associated 2-like, spermatogenesis-associated protein 2-like protein, tamo | |
| SPATA2L | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title