Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPATA2L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SPATA2L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156681
|
Novus Biologicals
NBP156681 |
100 μL |
Each for $436.00
|
|
NBP1566820
|
Novus Biologicals
NBP15668120UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
SPATA2L Polyclonal specifically detects SPATA2L in Human samples. It is validated for Western Blot.Specifications
| SPATA2L | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C16orf76, chromosome 16 open reading frame 76, MGC26885, SPATA2-like protein, spermatogenesis associated 2-like, spermatogenesis-associated protein 2-like protein, tamo | |
| SPATA2L | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IUW3 | |
| 124044 | |
| Synthetic peptides corresponding to SPATA2L(spermatogenesis associated 2-like) The peptide sequence was selected from the middle region of SPATA2L. Peptide sequence SPPAELAYRPPLWEQSAKLWGTGGRAWEPPAEELPQASSPPYGALEEGLE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title