Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPATA7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SPATA7 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SPATA7 Polyclonal specifically detects SPATA7 in Human samples. It is validated for Western Blot.Specifications
SPATA7 | |
Polyclonal | |
Rabbit | |
Q9P0W8 | |
55812 | |
Synthetic peptides corresponding to SPATA7(spermatogenesis associated 7) The peptide sequence was selected from the middle region of SPATA7. Peptide sequence FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
HSD-3.1, HSD3DKFZp686D07199, LCA3, Leber congenital amaurosis 3, MGC102934, spermatogenesis associated 7, spermatogenesis-associated protein 7, Spermatogenesis-associated protein HSD3 | |
SPATA7 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title