SPATA9 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159460

Catalog No. NBP159460

Description

SPATA9 Polyclonal specifically detects SPATA9 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SPATA9
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BWV2
• Gene Symbols: SPATA9
• Immunogen: Synthetic peptides corresponding to SPATA9(spermatogenesis associated 9) The peptide sequence was selected from the N terminal of SPATA9. Peptide sequence PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Pig: 100%; Rabbit: 92%; Rat: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ35906, NYD-SP16, spermatogenesis associated 9, spermatogenesis-associated protein 9, Testis development protein NYD-SP16
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83890
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.