Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SPDEF Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen SPDEF
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17423720
View Documents
Novus Biologicals
NBP17423720UL
20 μL
Each for $152.22
Add to cart
 
NBP174237
View Documents
Novus Biologicals
NBP174237
100 μL
Each for $436.00
Add to cart
 
Description

Description

SPDEF Polyclonal specifically detects SPDEF in Human samples. It is validated for Western Blot.
Specifications

Specifications

SPDEF
Polyclonal
Rabbit
O95238
25803
Synthetic peptides corresponding to the C terminal of SPDEF. Immunizing peptide sequence FKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
bA375E1.3, PDEFRP11-375E1__A.3, Prostate epithelium-specific Ets transcription factor, Prostate-derived Ets factor, Prostate-specific Ets, PSE, SAM pointed domain containing ets transcription factor, SAM pointed domain-containing Ets transcription factor
SPDEF
IgG
Affinity Purified
37 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit