Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPDEF Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | SPDEF |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17423720
|
Novus Biologicals
NBP17423720UL |
20 μL |
Each for $152.22
|
|
NBP174237
|
Novus Biologicals
NBP174237 |
100 μL |
Each for $436.00
|
|
Description
SPDEF Polyclonal specifically detects SPDEF in Human samples. It is validated for Western Blot.Specifications
SPDEF | |
Polyclonal | |
Rabbit | |
O95238 | |
25803 | |
Synthetic peptides corresponding to the C terminal of SPDEF. Immunizing peptide sequence FKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
bA375E1.3, PDEFRP11-375E1__A.3, Prostate epithelium-specific Ets transcription factor, Prostate-derived Ets factor, Prostate-specific Ets, PSE, SAM pointed domain containing ets transcription factor, SAM pointed domain-containing Ets transcription factor | |
SPDEF | |
IgG | |
Affinity Purified | |
37 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title