Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPG21 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309474100UL
Description
SPG21 Polyclonal specifically detects SPG21 in Human samples. It is validated for Western Blot.Specifications
SPG21 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Acid cluster protein 33, ACP33Spastic paraplegia 21 protein, GL010, MASPARDIN, MASTBM-019, spastic paraplegia 21 (autosomal recessive, Mast syndrome), Spastic paraplegia 21 autosomal recessive Mast syndrome protein | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPG21 (NP_057714). Peptide sequence LCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ | |
100 μg | |
Neurodegeneration | |
51324 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction