Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPICE1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | SPICE1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1707220
|
Novus Biologicals
NBP17071220UL |
20 μL |
Each for $152.22
|
|
NBP170712
|
Novus Biologicals
NBP170712 |
100 μL |
Each for $436.00
|
|
Description
SPICE1 Polyclonal specifically detects SPICE1 in Human samples. It is validated for Western Blot.Specifications
SPICE1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CCDC52, FLJ26064, SPICE, spindle and centriole associated protein 1 | |
SPICE1 | |
IgG | |
Affinity Purified | |
96 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8N0Z3 | |
152185 | |
Synthetic peptides corresponding to CCDC52(coiled-coil domain containing 52) The peptide sequence was selected from the middle region of CCDC52 (NP_653319). Peptide sequence KEQNWEEKTLPIDTDIQNSSEENRLFTQRWRVSHMGEDLENKTQAPFVNL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title