Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPINT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP26260425UL
Description
SPINT3 Polyclonal antibody specifically detects SPINT3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
SPINT3 | |
Polyclonal | |
Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
HKIB9, Kunitz-Type Protease Inhibitor 3, Serine Peptidase Inhibitor, Kunitz Type, 3, Serine Protease Inhibitor Kunitz Type 3 | |
This antibody was developed against a recombinant protein corresponding to amino acids: DTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCKFT | |
25 μL | |
Primary | |
Human | |
Purified |
Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol | |
Rabbit | |
Protein A purified | |
RUO | |
10816 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction