Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Splicing factor, arginine/serine-rich 11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Splicing factor, arginine/serine-rich 11 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Splicing factor, arginine/serine-rich 11 Polyclonal specifically detects Splicing factor, arginine/serine-rich 11 in Human samples. It is validated for Western Blot.Specifications
Splicing factor, arginine/serine-rich 11 | |
Polyclonal | |
Rabbit | |
Q05519 | |
9295 | |
Synthetic peptides corresponding to SFRS11(splicing factor, arginine/serine-rich 11) The peptide sequence was selected from the C terminal of SFRS11. Peptide sequence KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Arginine-rich 54 kDa nuclear protein, dJ677H15.2, DKFZp686M13204, p54NET2, serine/arginine-rich splicing factor 11, SFRS11, splicing factor p54, Splicing factor, arginine/serine-rich 11FLJ18226, SR splicing factor 11 | |
SRSF11 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title