Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Splicing factor, arginine/serine-rich 11 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Splicing factor, arginine/serine-rich 11
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157324
View Documents
Novus Biologicals
NBP157324
100 μL
Each for $436.00
Add to cart
 
NBP15732420
View Documents
Novus Biologicals
NBP15732420UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

Splicing factor, arginine/serine-rich 11 Polyclonal specifically detects Splicing factor, arginine/serine-rich 11 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Splicing factor, arginine/serine-rich 11
Polyclonal
Rabbit
Q05519
9295
Synthetic peptides corresponding to SFRS11(splicing factor, arginine/serine-rich 11) The peptide sequence was selected from the C terminal of SFRS11. Peptide sequence KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
Arginine-rich 54 kDa nuclear protein, dJ677H15.2, DKFZp686M13204, p54NET2, serine/arginine-rich splicing factor 11, SFRS11, splicing factor p54, Splicing factor, arginine/serine-rich 11FLJ18226, SR splicing factor 11
SRSF11
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit