SPRR3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157679

Catalog No. NBP157679

Description

SPRR3 Polyclonal specifically detects SPRR3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SPRR3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UBC9
• Gene Symbols: SPRR3
• Immunogen: Synthetic peptides corresponding to SPRR3(small proline-rich protein 3) The peptide sequence was selected from the middle region of SPRR3. Peptide sequence DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ.
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 6707
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: 22 kDa pancornulin, Cornifin beta, Esophagin, small proline-rich protein 3, SPRC
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rat: 92%; Bovine: 85%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Rabbit
• Isotype: IgG